SF-1/NR5A1/Steroidogenic Factor 1 Antibody, Novus Biologicals™

SF-1/NR5A1/Steroidogenic Factor 1

Polyclonal

Unconjugated

PBS, 2% Sucrose with 0.09% Sodium Azide

AD4BPSTF-1, Adrenal 4-binding protein, ELP, FTZ1adrenal 4 binding protein, FTZF1nuclear receptor AdBP4, Fushi tarazu factor homolog 1, Nuclear receptor subfamily 5 group A member 1, nuclear receptor subfamily 5, group A, member 1, SF-1POF7, SF1steroidogenic factor 1, Steroid hormone receptor Ad4BP, steroidogenic factor-1

Rabbit

52 kDa

100 μL

Primary

Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 90%; Canine: 85%; Pig: 84%; Rabbit: 78%.

Human, Mouse, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep

IgG

Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

0.5 mg/ml

Western Blot 1.0 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 4-8 ug/ml

Q13285

NR5A1

Synthetic peptides corresponding to SF1/Steroidogenic Factor 1 The peptide sequence was selected from the middle region of SF1/Steroidogenic Factor 1. Peptide sequence SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA.

Affinity purified

RUO

2516

Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.