G protein alpha inhibitor 1 Antibody, Novus Biologicals™

G protein alpha inhibitor 1

Polyclonal

Unconjugated

PBS, 2% Sucrose with 0.09% Sodium Azide

Adenylate cyclase-inhibiting G alpha protein, Gi, Gi1 protein alpha subunit, guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 1, guanine nucleotide-binding protein G(i) subunit alpha-1

Rabbit

40 kDa

100 μL

Signal Transduction

2770

Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Western Blot

0.5 mg/ml

Western Blot 1.0 ug/ml

P63096

GNAI1

Synthetic peptides corresponding to GNAI1(guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1) The peptide sequence was selected from the middle region of GNAI1 (NP_002060). Peptide sequence YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH The peptide sequence for this immunogen was taken from within the described region.

Affinity purified

RUO

Primary

This product is specific to Subunit or Isoform: alpha-1.

Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Yeast, Zebrafish

IgG