PPP2R3A Antibody, Novus Biologicals™

PPP2R3A

Polyclonal

Unconjugated

PBS, 2% Sucrose with 0.09% Sodium Azide

PP2A subunit B isoform R3 isoform, PP2A subunit B isoforms B72/B130, PP2A subunit B isoforms B'-PR72/PR130, protein phosphatase 2 (formerly 2A), regulatory subunit B' (PR 72), alphaisoform and (PR 130), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha, serine/threonine-protein phosphatase 2A regulatory subunit B' subunit alpha, subunit B, R3 isoform

Rabbit

130 kDa

100 μL

Primary

This product is specific to Subunit or Isoform: B.

Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit

IgG

Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

0.5 mg/ml

Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500

Q06190

PPP2R3A

Synthetic peptides corresponding to PPP2R3A(protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha) The peptide sequence was selected from the N terminal of PPP2R3A. Peptide sequence SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD The peptide sequence for this immunogen was taken from within the described region.

Affinity purified

RUO

5523

Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.