PA28 Activator gamma Subunit/PSME3 Antibody, Novus Biologicals™

PA28 Activator gamma Subunit/PSME3

Polyclonal

Unconjugated

PBS, 2% Sucrose with 0.09% Sodium Azide

11S regulator complex gamma subunit, 11S regulator complex subunit gamma, Activator of multicatalytic protease subunit 3, Ki, Ki antigen, PA28g, PA28gamma, PA28-gamma, PA28GKi nuclear autoantigen, proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki), Proteasome activator 28 subunit gamma, proteasome activator 28-gamma, proteasome activator complex subunit 3, REG-gamma

Rabbit

31 kDa

100 μL

Core ESC Like Genes, Immune System Diseases, Immunology, Neuroscience, Stem Cell Markers, Ubiquitin Proteasome Pathway

10197

Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

0.5 mg/ml

Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml

P61289-2

PSME3

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PA28 Activator gamma Subunit/PSME3. Peptide Sequence PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ. The peptide sequence for this immunogen was taken from within the described region.

Affinity purified

RUO

Primary

This product is specific to Subunit or Isoform: 3.

Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit

IgG