Calcineurin B Antibody, Novus Biologicals™

Calcineurin B

Polyclonal

Unconjugated

PBS, 2% Sucrose with 0.09% Sodium Azide

calcineurin subunit B type 1, CNA2, CNB1, Protein phosphatase 2B regulatory subunit 1, protein phosphatase 2B regulatory subunit B alpha, protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform(calcineurin B, type I), protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform(calcineurin B, type I), protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform, Protein phosphatase 3 regulatory subunit B alpha isoform 1, protein phosphatase 3, regulatory subunit B, alpha, type I (19kDa)

Rabbit

Affinity purified

RUO

Primary

This product is specific to Subunit or Isoform: B type 1.

Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish

IgG

Western Blot

0.5 mg/ml

Western Blot 1.0 ug/ml

P63098

PPP3R1

Synthetic peptides corresponding to PPP3R1(protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform) The peptide sequence was selected from the N terminal of PPP3R1. Peptide sequence MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ The peptide sequence for this immunogen was taken from within the described region.

100 μL

Protein Phosphatase, Signal Transduction, Wnt Signaling Pathway

5534

Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.