Serpin C1/Antithrombin-III Antibody, Novus Biologicals™

Serpin C1/Antithrombin-III

Polyclonal

Unconjugated

PBS, 2% Sucrose with 0.09% Sodium Azide

AT3antithrombin-III, ATIIIantithrombin III, MGC22579, serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1, serine-cysteine proteinase inhibitor clade C member 1, Serpin C1, serpin peptidase inhibitor, clade C (antithrombin), member 1

Rabbit

52 kDa

100 μL

Primary

Expected identity based on immunogen sequence: Canine: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Bovine: 92%; Guinea pig: 92%; Equine: 92%; Human: 92%; Zebrafish: 92%; Chicken: 85%.

Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish

IgG

Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

0.5 mg/ml

Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500

P01008

SERPINC1

Synthetic peptides corresponding to SERPINC1(serpin peptidase inhibitor, clade C (antithrombin), member 1) The peptide sequence was selected from the middle region of SERPINC1. Peptide sequence ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD The peptide sequence for this immunogen was taken from within the described region.

Affinity purified

RUO

462

Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.